SCOPe 2.06: Domain d3vf5a_: 3vf5 A:

Lineage for d3vf5a_ (3vf5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)

8. Domain d3vf5a_: 3vf5 A: [194277]
   automated match to d2aoda_
   complexed with 031, act, cl, gol, na; mutant

Details for d3vf5a_

PDB Entry: 3vf5, 1.25 Å

PDB Description: crystal structure of hiv-1 protease mutant i47v with novel p1'-ligands grl-02031

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3vf5a_:

Sequence; same for both SEQRES and ATOM records:

>d3vf5a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmvggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3vf5a_:

• d3vf5a_ first appeared in SCOPe 2.02
  
• d3vf5a_ appears in SCOPe 2.05
  
• d3vf5a_ appears in SCOPe 2.07
  
• d3vf5a_ appears in the current release, SCOPe 2.08