Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (13 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [194255] (5 PDB entries) |
Domain d3us7a_: 3us7 A: [194256] automated match to d2flhb_ complexed with ga3, gol |
PDB Entry: 3us7 (more details), 1.34 Å
SCOPe Domain Sequences for d3us7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3us7a_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]} mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis ydheselieekvkptktsestlfylgqlekflln
Timeline for d3us7a_: