Lineage for d3us7a_ (3us7 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218562Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1218563Protein automated matches [190218] (6 species)
    not a true protein
  7. 1218569Species Medicago truncatula [TaxId:3880] [194255] (2 PDB entries)
  8. 1218570Domain d3us7a_: 3us7 A: [194256]
    automated match to d2flhb_
    complexed with ga3, gol

Details for d3us7a_

PDB Entry: 3us7 (more details), 1.34 Å

PDB Description: Crystal Structure of Phytohormone Binding Protein from Medicago truncatula in complex with gibberellic acid (GA3)
PDB Compounds: (A:) Phytohormone Binding Protein

SCOPe Domain Sequences for d3us7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3us7a_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
ydheselieekvkptktsestlfylgqlekflln

SCOPe Domain Coordinates for d3us7a_:

Click to download the PDB-style file with coordinates for d3us7a_.
(The format of our PDB-style files is described here.)

Timeline for d3us7a_: