SCOPe 2.06: Domain d4esba_: 4esb A:

Lineage for d4esba_ (4esb A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [186878] (2 PDB entries)

8. Domain d4esba_: 4esb A: [194251]
   automated match to d3hhhb_
   complexed with gol, so4

Details for d4esba_

PDB Entry: 4esb, 2.5 Å

PDB Description: Crystal structure of PadR-like transcriptional regulator (BC4206) from Bacillus cereus strain ATCC 14579

PDB Compounds: (A:) Transcriptional regulator, PadR family

SCOPe Domain Sequences for d4esba_:

Sequence; same for both SEQRES and ATOM records:

>d4esba_ a.4.5.0 (A:) automated matches {Bacillus cereus [TaxId: 226900]}
sqmlkgvlegcilyiisqeevygyelstklnkhgftfvsegsiyplllrmqkekliegtl
kasslgpkrkyyhitdkgleqleefkqswgmvsttvnnllqge

Timeline for d4esba_:

• d4esba_ first appeared in SCOPe 2.02
  
• d4esba_ appears in SCOPe 2.05
  
• d4esba_ appears in SCOPe 2.07
  
• d4esba_ appears in the current release, SCOPe 2.08