Lineage for d4f4pa_ (4f4p A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435550Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 1435551Species Human (Homo sapiens) [TaxId:9606] [118132] (25 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 1435575Domain d4f4pa_: 4f4p A: [194235]
    automated match to d1xbba_
    complexed with 0sb, so4

Details for d4f4pa_

PDB Entry: 4f4p (more details), 2.37 Å

PDB Description: syk in complex with ligand lasw836
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4f4pa_:

Sequence, based on SEQRES records: (download)

>d4f4pa_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
ldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanvm
qqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmky
leesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapeci
nyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydl
mnlcwtydvenrpgfaavelrlrnyyydvvneg

Sequence, based on observed residues (ATOM records): (download)

>d4f4pa_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
ldrklltledkelgsgnfgtvkkgyvktvavkilkpalkdellaeanvmqqldnpyivrm
igiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfvhrdl
aarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfssksdv
wsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydven
rpgfaavelrlrnyyydvvneg

SCOPe Domain Coordinates for d4f4pa_:

Click to download the PDB-style file with coordinates for d4f4pa_.
(The format of our PDB-style files is described here.)

Timeline for d4f4pa_: