Lineage for d4gsoa_ (4gso A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1129221Protein automated matches [190044] (13 species)
    not a true protein
  7. 1129229Species Bothrops jararacussu [TaxId:8726] [194232] (1 PDB entry)
  8. 1129230Domain d4gsoa_: 4gso A: [194233]
    automated match to d1op2a_

Details for d4gsoa_

PDB Entry: 4gso (more details), 2.6 Å

PDB Description: structure of Jararacussin-I
PDB Compounds: (A:) Thrombin-like enzyme BjussuSP-1

SCOPe Domain Sequences for d4gsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gsoa_ b.47.1.2 (A:) automated matches {Bothrops jararacussu [TaxId: 8726]}
vlggdecdinehpflaflyshgyfcgltlinqewvvtaahcdstnfqmqlgvhskkvlne
deqtrnpkekficpnknmsevldkdimlikldkpisnskhiaplslpsnppsvgsvcrim
gwgsitipnetypdvpycaninlvdyevcqgaynglpakttlcagvleggkdtcvgdsgg
plicngqfqgivsygahscgqgpkpgiytnvfdytdwiqrniagntdatcpp

SCOPe Domain Coordinates for d4gsoa_:

Click to download the PDB-style file with coordinates for d4gsoa_.
(The format of our PDB-style files is described here.)

Timeline for d4gsoa_: