Lineage for d4fn6b_ (4fn6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732899Species Staphylococcus aureus [TaxId:282458] [194218] (1 PDB entry)
  8. 2732901Domain d4fn6b_: 4fn6 B: [194219]
    automated match to d3no6b_
    complexed with act, gol

Details for d4fn6b_

PDB Entry: 4fn6 (more details), 2.69 Å

PDB Description: Structural Characterization of Thiaminase type II TenA from Staphylococcus aureus
PDB Compounds: (B:) thiaminase-2

SCOPe Domain Sequences for d4fn6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fn6b_ a.132.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mefsqklyqaakpiindiyeddfiqkmllgniqadalrhylqadaaylkeftnlyallip
kmnsmndvkflveqiefmvegevlahdilaqivgesyeeiiktkvwppsgdhyikhmyfq
ahsrenaiytiaamapcpyiyaelakrsqsdhklnrekdtakwfdfystemddiinvfes
lmnklaesmsdkeleqvkqvflesciherrffnmamtleqwefgg

SCOPe Domain Coordinates for d4fn6b_:

Click to download the PDB-style file with coordinates for d4fn6b_.
(The format of our PDB-style files is described here.)

Timeline for d4fn6b_: