Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein Beta-glucosidase A [51528] (9 species) |
Species Uncultured bacterium [TaxId:77133] [188736] (6 PDB entries) |
Domain d4hz6a_: 4hz6 A: [194206] automated match to d3fiya_ complexed with gol |
PDB Entry: 4hz6 (more details), 1.4 Å
SCOPe Domain Sequences for d4hz6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hz6a_ c.1.8.4 (A:) Beta-glucosidase A {Uncultured bacterium [TaxId: 77133]} kkfpegflwgaatssyqiegawnedgkgesiwdrftripgkikngdsgdvacdhyhryeq dldlmrqlglktyrfsiawariqpdssrqinqrgldfyrrlveglhkrdilpmatlyhwd lpqwvedeggwlsresasrfaeythalvaalgdqiplwvthnepmvtvwagyhmglfapg lkdptlggrvahhlllshgqalqafralspagsqmgitlnfntiypvsaepadveaarrm hsfqnelfleplirgqynqatlmaypnlpefiapedmqtisapidflgvnyynpmrvkss pqppgievvqvespvtamgweiapeglydllmgitrtygklpiyitengaafddqpdqsg qvndpqrvgyfqghigaarraladgvdlrgyyawslldnfewaegyskrfgiiyvdfetq qrtlkqsaqwyrdvianngle
Timeline for d4hz6a_: