Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (4 species) not a true protein |
Species Aura virus [TaxId:44158] [194195] (3 PDB entries) |
Domain d4agka_: 4agk A: [194197] automated match to d1kxfa_ |
PDB Entry: 4agk (more details), 1.81 Å
SCOPe Domain Sequences for d4agka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4agka_ b.47.1.3 (A:) automated matches {Aura virus [TaxId: 44158]} drtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmefaklpte mksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsgkvvaivlg ganegartalsvvtwnkkgaaiktthedtvew
Timeline for d4agka_: