Lineage for d4agka_ (4agk A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1129399Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1129486Protein automated matches [190658] (3 species)
    not a true protein
  7. 1129487Species Aura virus [TaxId:44158] [194195] (3 PDB entries)
  8. 1129488Domain d4agka_: 4agk A: [194197]
    automated match to d1kxfa_

Details for d4agka_

PDB Entry: 4agk (more details), 1.81 Å

PDB Description: Crystal structure of capsid protein (110-267) from Aura virus
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d4agka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4agka_ b.47.1.3 (A:) automated matches {Aura virus [TaxId: 44158]}
drtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmefaklpte
mksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsgkvvaivlg
ganegartalsvvtwnkkgaaiktthedtvew

SCOPe Domain Coordinates for d4agka_:

Click to download the PDB-style file with coordinates for d4agka_.
(The format of our PDB-style files is described here.)

Timeline for d4agka_: