SCOPe 2.02: Domain d3vmla_: 3vml A:

Lineage for d3vmla_ (3vml A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (15 species)
   not a true protein

7. Species Shewanella oneidensis, [TaxId:211586] [194175] (3 PDB entries)

8. Domain d3vmla_: 3vml A: [194176]
   automated match to d1cnza_
   complexed with cl, ipm, mg

Details for d3vmla_

PDB Entry: 3vml, 1.56 Å

PDB Description: chimera 3-isopropylmalate dehydrogenase between shewanella oneidensis mr-1 (o) and shewanella benthica db21 mt-2 (m) from n-terminal: 20% o middle 70% m residual 10% o

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3vmla_:

Sequence; same for both SEQRES and ATOM records:

>d3vmla_ c.77.1.1 (A:) automated matches {Shewanella oneidensis, [TaxId: 211586]}
ssyqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaidnhgcplpeatl
kgceaadavlfgsvggpkwehlppndqpergallplrghfelfcnmrpaklhpglehmsp
lrsdisekgfdilcvreltggiyfgkpkgrqgegeneeafdtmrysrkeirriakiafes
aqgrrkkvtsvdkanvlacsvlwrevveevakdypdvelehiyidnatmqllrrpnefdv
mlcsnlfgdivsdeiamltgsmgllasismnsqgfgmyepaggsapdiagqgianpvaqi
lsaalllrhslkledaalaieaavskalnsgyltgellssdqrhkakttvqmgdfiadav
kag

Timeline for d3vmla_:

• d3vmla_ is new in SCOPe 2.02-stable
  
• d3vmla_ appears in SCOPe 2.03
  
• d3vmla_ appears in the current release, SCOPe 2.08, called d3vmla1