SCOPe 2.02: Domain d3zbwa_: 3zbw A:

Lineage for d3zbwa_ (3zbw A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries)

8. Domain d3zbwa_: 3zbw A: [194169]
   automated match to d2bwla_
   complexed with acy, so4, zn

Details for d3zbwa_

PDB Entry: 3zbw, 1.8 Å

PDB Description: Crystal Structure of murine Angiogenin-3

PDB Compounds: (A:) angiogenin-3

SCOPe Domain Sequences for d3zbwa_:

Sequence; same for both SEQRES and ATOM records:

>d3zbwa_ d.5.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dnyryikfltqhydakptgrdyrycesmmkkrkltspckevntfihdtknnikaicgeng
npygvnfrisnsrfqvttcthkggsprppcqynafkdfryiviacedgwpvhfdesfisp

Timeline for d3zbwa_:

• d3zbwa_ is new in SCOPe 2.02-stable
  
• d3zbwa_ appears in SCOPe 2.03
  
• d3zbwa_ appears in the current release, SCOPe 2.08