Lineage for d4fjsb_ (4fjs B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1188934Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 1188935Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (1 family) (S)
    topological similarity to the domain 2 of TM1585
  5. 1188936Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 1188969Protein automated matches [194139] (2 species)
    not a true protein
  7. 1188970Species Escherichia coli [TaxId:316385] [194144] (2 PDB entries)
  8. 1188974Domain d4fjsb_: 4fjs B: [194147]
    automated match to d1xrha_

Details for d4fjsb_

PDB Entry: 4fjs (more details), 2.13 Å

PDB Description: crystal structure of ureidoglycolate dehydrogenase enzyme in apo form
PDB Compounds: (B:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d4fjsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjsb_ c.122.1.1 (B:) automated matches {Escherichia coli [TaxId: 316385]}
isretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskggtn
repefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsgaisy
fvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattvqaw
gkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvllgl
pfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgfnqv
yypgqdqdikqrkaa

SCOPe Domain Coordinates for d4fjsb_:

Click to download the PDB-style file with coordinates for d4fjsb_.
(The format of our PDB-style files is described here.)

Timeline for d4fjsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fjsa_