SCOPe 2.06: Domain d4fxwa1: 4fxw A:375-475

Lineage for d4fxwa1 (4fxw A:375-475)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Splicing factor U2AF 65 KDa subunit [54936] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54937] (8 PDB entries)

8. Domain d4fxwa1: 4fxw A:375-475 [194143]
   Other proteins in same PDB: d4fxwa2, d4fxwc2
   automated match to d1o0pa_
   protein/RNA complex; complexed with so4

Details for d4fxwa1

PDB Entry: 4fxw, 2.29 Å

PDB Description: structure of phosphorylated sf1 complex with u2af65-uhm domain

PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d4fxwa1:

Sequence; same for both SEQRES and ATOM records:

>d4fxwa1 d.58.7.1 (A:375-475) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}
tevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgkifv
eftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

Timeline for d4fxwa1:

• d4fxwa1 first appeared in SCOPe 2.02, called d4fxwa_
  
• d4fxwa1 was called d4fxwa_ in SCOPe 2.05
  
• d4fxwa1 appears in SCOPe 2.07
  
• d4fxwa1 appears in the current release, SCOPe 2.08