SCOPe 2.04: Domain d4hbna_: 4hbn A:

Lineage for d4hbna_ (4hbn A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries)

8. Domain d4hbna_: 4hbn A: [194138]
   automated match to d3u11b_
   complexed with cmp, po4; mutant

Details for d4hbna_

PDB Entry: 4hbn, 2.6 Å

PDB Description: Crystal structure of the human HCN4 channel C-terminus carrying the S672R mutation

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d4hbna_:

Sequence, based on SEQRES records:

>d4hbna_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
vsvltkgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmm
rrafetvaldrldrigkkns

Sequence, based on observed residues (ATOM records):

>d4hbna_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
vsvltgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkkns

Timeline for d4hbna_:

• d4hbna_ first appeared in SCOPe 2.02
  
• d4hbna_ appears in SCOPe 2.03
  
• d4hbna_ appears in SCOPe 2.05
  
• d4hbna_ appears in the current release, SCOPe 2.08, called d4hbna1