Lineage for d4hbna_ (4hbn A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138884Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 1138890Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1138996Protein automated matches [190352] (5 species)
    not a true protein
  7. 1138997Species Human (Homo sapiens) [TaxId:9606] [189505] (4 PDB entries)
  8. 1139002Domain d4hbna_: 4hbn A: [194138]
    automated match to d3u11b_
    complexed with cmp, po4; mutant

Details for d4hbna_

PDB Entry: 4hbn (more details), 2.6 Å

PDB Description: Crystal structure of the human HCN4 channel C-terminus carrying the S672R mutation
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d4hbna_:

Sequence, based on SEQRES records: (download)

>d4hbna_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
vsvltkgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmm
rrafetvaldrldrigkkns

Sequence, based on observed residues (ATOM records): (download)

>d4hbna_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
vsvltgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkkns

SCOPe Domain Coordinates for d4hbna_:

Click to download the PDB-style file with coordinates for d4hbna_.
(The format of our PDB-style files is described here.)

Timeline for d4hbna_:

  • d4hbna_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-27
  • d4hbna_ appears in SCOPe 2.03
  • d4hbna_ appears in the current release, SCOPe 2.07, called d4hbna1