SCOPe 2.03: Domain d4i1og_: 4i1o G:

Lineage for d4i1og_ (4i1o G:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)

8. Domain d4i1og_: 4i1o G: [194137]
   automated match to d3nkva_
   complexed with bef, gdp, mg, peg

Details for d4i1og_

PDB Entry: 4i1o, 2.7 Å

PDB Description: Crystal structure of the Legionella pneumophila GAP domain of LepB in complex with Rab1b bound to GDP and BeF3

PDB Compounds: (G:) Ras-related protein Rab-1B

SCOPe Domain Sequences for d4i1og_:

Sequence; same for both SEQRES and ATOM records:

>d4i1og_ c.37.1.8 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlfq

Timeline for d4i1og_:

• d4i1og_ first appeared in SCOPe 2.02
  
• d4i1og_ appears in SCOPe 2.04
  
• d4i1og_ appears in the current release, SCOPe 2.08, called d4i1og1