SCOPe 2.06: Domain d4i6lb1: 4i6l B:1-73

Lineage for d4i6lb1 (4i6l B:1-73)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (8 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (209 PDB entries)
   Uniprot P62988
   identical sequence in many other species

8. Domain d4i6lb1: 4i6l B:1-73 [194132]
   Other proteins in same PDB: d4i6la1, d4i6la2, d4i6lb2
   automated match to d3noba_

Details for d4i6lb1

PDB Entry: 4i6l, 2.49 Å

PDB Description: Crystal structure of OTUB1 in complex with ubiquitin variant

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d4i6lb1:

Sequence; same for both SEQRES and ATOM records:

>d4i6lb1 d.15.1.1 (B:1-73) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqkllfarkqledgrtlsdyn
ihkesflylvlrl

Timeline for d4i6lb1:

• d4i6lb1 first appeared in SCOPe 2.02, called d4i6lb_
  
• d4i6lb1 was called d4i6lb_ in SCOPe 2.05
  
• d4i6lb1 appears in SCOPe 2.07
  
• d4i6lb1 appears in the current release, SCOPe 2.08