SCOPe 2.04: Domain d4i6lb_: 4i6l B:

Lineage for d4i6lb_ (4i6l B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (126 PDB entries)
   Uniprot P62988
   identical sequence in many other species

8. Domain d4i6lb_: 4i6l B: [194132]
   Other proteins in same PDB: d4i6la_
   automated match to d3noba_

Details for d4i6lb_

PDB Entry: 4i6l, 2.49 Å

PDB Description: Crystal structure of OTUB1 in complex with ubiquitin variant

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d4i6lb_:

Sequence; same for both SEQRES and ATOM records:

>d4i6lb_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqkllfarkqledgrtlsd
ynihkesflylvlrl

Timeline for d4i6lb_:

• d4i6lb_ first appeared in SCOPe 2.02
  
• d4i6lb_ appears in SCOPe 2.03
  
• d4i6lb_ appears in SCOPe 2.05
  
• d4i6lb_ appears in the current release, SCOPe 2.07, called d4i6lb1