Class a: All alpha proteins [46456] (284 folds) |
Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies) core: 5 helices; bundle |
Superfamily a.70.2: AF1862-like [158568] (2 families) probable biological unit is a hexamer |
Family a.70.2.0: automated matches [194080] (1 protein) not a true family |
Protein automated matches [194081] (2 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [194107] (1 PDB entry) |
Domain d4gkfa_: 4gkf A: [194109] automated match to d2oeba1 |
PDB Entry: 4gkf (more details), 2.1 Å
SCOPe Domain Sequences for d4gkfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gkfa_ a.70.2.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]} rktleqrrgeyayyvikevadlndkqleekyaslvkkapvmilsngllqtlafllakaet spekanqilsrvneypprfieklgndkdehlllylhivywlrenvdrnidvktllsqdys kvlwatkeaiallnwmrrfavamlke
Timeline for d4gkfa_: