SCOPe 2.05: Domain d4dyxa_: 4dyx A:

Lineage for d4dyxa_ (4dyx A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (19 PDB entries)

8. Domain d4dyxa_: 4dyx A: [194091]
   automated match to d2fhaa_
   complexed with ca, cu

Details for d4dyxa_

PDB Entry: 4dyx, 1.85 Å

PDB Description: Crystal Structure of the Cu-adduct of Human H-Ferritin variant 4His-delta C-star

PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d4dyxa_:

Sequence; same for both SEQRES and ATOM records:

>d4dyxa_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyfhhqsheehe
hahklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklatdk
ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d4dyxa_:

• d4dyxa_ first appeared in SCOPe 2.02
  
• d4dyxa_ appears in SCOPe 2.04
  
• d4dyxa_ appears in SCOPe 2.06
  
• d4dyxa_ appears in the current release, SCOPe 2.08