SCOPe 2.02: Domain d4f60a_: 4f60 A:

Lineage for d4f60a_ (4f60 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (3 species)
   not a true protein

7. Species Rhodococcus rhodochrous [TaxId:1829] [189127] (6 PDB entries)

8. Domain d4f60a_: 4f60 A: [194086]
   automated match to d3fwha_
   complexed with f; mutant

Details for d4f60a_

PDB Entry: 4f60, 1.45 Å

PDB Description: Crystal structure of Rhodococcus rhodochrous haloalkane dehalogenase mutant (T148L, G171Q, A172V, C176F).

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4f60a_:

Sequence; same for both SEQRES and ATOM records:

>d4f60a_ c.69.1.8 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdewpefarelfqafrtadvgreliidqnafieqvlpkfvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

Timeline for d4f60a_:

• d4f60a_ is new in SCOPe 2.02-stable
  
• d4f60a_ appears in SCOPe 2.03
  
• d4f60a_ appears in the current release, SCOPe 2.08