Lineage for d4h9lm_ (4h9l M:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239027Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1239028Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1239029Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1239184Protein automated matches [190224] (5 species)
    not a true protein
  7. 1239196Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries)
  8. 1239248Domain d4h9lm_: 4h9l M: [194078]
    Other proteins in same PDB: d4h9ll_
    automated match to d2j8dm_
    complexed with bcl, bph, fe, spo, u10

Details for d4h9lm_

PDB Entry: 4h9l (more details), 2.77 Å

PDB Description: bacterial photosynthetic reaction center from rhodobacter sphaeroides with ile m265 replaced with ser
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4h9lm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9lm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegshrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

SCOPe Domain Coordinates for d4h9lm_:

Click to download the PDB-style file with coordinates for d4h9lm_.
(The format of our PDB-style files is described here.)

Timeline for d4h9lm_: