SCOPe 2.05: Domain d4hutb_: 4hut B:

Lineage for d4hutb_ (4hut B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein automated matches [190393] (10 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [194072] (1 PDB entry)

8. Domain d4hutb_: 4hut B: [194073]
   automated match to d1g64b_
   complexed with atp, b12, edo, mg

Details for d4hutb_

PDB Entry: 4hut, 1.95 Å

PDB Description: Structure of ATP:co(I)rrinoid adenosyltransferase (CobA) from Salmonella enterica in complex with four and five-coordinate cob(II)alamin and ATP

PDB Compounds: (B:) Cob(I)yrinic acid a,c-diamide adenosyltransferase

SCOPe Domain Sequences for d4hutb_:

Sequence; same for both SEQRES and ATOM records:

>d4hutb_ c.37.1.11 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
rgiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqvm
atgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisal
narpghqtviitgrgchrdildladtvselrpvkhafdagvkaqmgidy

Timeline for d4hutb_:

• d4hutb_ first appeared in SCOPe 2.02
  
• d4hutb_ appears in SCOPe 2.04
  
• d4hutb_ appears in SCOPe 2.06
  
• d4hutb_ appears in the current release, SCOPe 2.08