Lineage for d3vfia_ (3vfi A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169725Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1169726Protein automated matches [190056] (50 species)
    not a true protein
  7. 1169885Species Silicibacter phage [TaxId:490912] [194069] (1 PDB entry)
  8. 1169886Domain d3vfia_: 3vfi A: [194070]
    automated match to d2h73a_

Details for d3vfia_

PDB Entry: 3vfi (more details), 1.75 Å

PDB Description: Crystal Structure of a Metagenomic Thioredoxin
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d3vfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vfia_ c.47.1.0 (A:) automated matches {Silicibacter phage [TaxId: 490912]}
lrslsdsdfqlevrqhpdpiiimftgswcqpckkmkptfeemasqmegdirfaymdaeda
ektmaelnirtlpslalfvdgmirevfsgtmnksdlrywinnni

SCOPe Domain Coordinates for d3vfia_:

Click to download the PDB-style file with coordinates for d3vfia_.
(The format of our PDB-style files is described here.)

Timeline for d3vfia_: