Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (50 species) not a true protein |
Species Silicibacter phage [TaxId:490912] [194069] (1 PDB entry) |
Domain d3vfia_: 3vfi A: [194070] automated match to d2h73a_ |
PDB Entry: 3vfi (more details), 1.75 Å
SCOPe Domain Sequences for d3vfia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vfia_ c.47.1.0 (A:) automated matches {Silicibacter phage [TaxId: 490912]} lrslsdsdfqlevrqhpdpiiimftgswcqpckkmkptfeemasqmegdirfaymdaeda ektmaelnirtlpslalfvdgmirevfsgtmnksdlrywinnni
Timeline for d3vfia_: