SCOPe 2.05: Domain d4dbpc_: 4dbp C:

Lineage for d4dbpc_ (4dbp C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries)

8. Domain d4dbpc_: 4dbp C: [194063]
   automated match to d4clna_
   complexed with ca, edo, ipa, tbu

Details for d4dbpc_

PDB Entry: 4dbp, 2.2 Å

PDB Description: myosin vi nucleotide-free (mdinsert2) d179y crystal structure

PDB Compounds: (C:) calmodulin

SCOPe Domain Sequences for d4dbpc_:

Sequence, based on SEQRES records:

>d4dbpc_ a.39.1.5 (C:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvtmmts

Sequence, based on observed residues (ATOM records):

>d4dbpc_ a.39.1.5 (C:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemiread
idgdgqvnyeefvtmmts

Timeline for d4dbpc_:

• d4dbpc_ first appeared in SCOPe 2.02
  
• d4dbpc_ appears in SCOPe 2.04
  
• d4dbpc_ appears in SCOPe 2.06
  
• d4dbpc_ appears in the current release, SCOPe 2.08