SCOPe 2.06: Domain d4heqa_: 4heq A:

Lineage for d4heqa_ (4heq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein automated matches [190443] (6 species)
   not a true protein

7. Species Desulfovibrio gigas [TaxId:879] [194059] (1 PDB entry)

8. Domain d4heqa_: 4heq A: [194061]
   automated match to d1fx1a_
   complexed with fmn

Details for d4heqa_

PDB Entry: 4heq, 1.3 Å

PDB Description: The crystal structure of flavodoxin from Desulfovibrio gigas

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d4heqa_:

Sequence; same for both SEQRES and ATOM records:

>d4heqa_ c.23.5.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
pkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstwg
ddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlva
sslkidgepdsaevldwarevlarv

Timeline for d4heqa_:

• d4heqa_ first appeared in SCOPe 2.02
  
• d4heqa_ appears in SCOPe 2.05
  
• d4heqa_ appears in SCOPe 2.07
  
• d4heqa_ appears in the current release, SCOPe 2.08