Lineage for d3vb2a_ (3vb2 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079976Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1080076Protein automated matches [190294] (4 species)
    not a true protein
  7. 1080079Species Escherichia coli [TaxId:83333] [193218] (3 PDB entries)
  8. 1080082Domain d3vb2a_: 3vb2 A: [194054]
    automated match to d1jgsa_

Details for d3vb2a_

PDB Entry: 3vb2 (more details), 2.6 Å

PDB Description: Crystal Structure of the Reduced Form of MarR from E.coli
PDB Compounds: (A:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d3vb2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vb2a_ a.4.5.28 (A:) automated matches {Escherichia coli [TaxId: 83333]}
neiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvlsvdl
galtrmldrlvskgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqeltknlt
adevatleyllkkvlp

SCOPe Domain Coordinates for d3vb2a_:

Click to download the PDB-style file with coordinates for d3vb2a_.
(The format of our PDB-style files is described here.)

Timeline for d3vb2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vb2b_