SCOPe 2.06: Domain d4b8zd_: 4b8z D:

Lineage for d4b8zd_ (4b8z D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d4b8zd_: 4b8z D: [194050]
   Other proteins in same PDB: d4b8zb2
   automated match to d1bsva_
   complexed with gdp, nap

Details for d4b8zd_

PDB Entry: 4b8z, 2.75 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, rhombohedral crystal form

PDB Compounds: (D:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4b8zd_:

Sequence; same for both SEQRES and ATOM records:

>d4b8zd_ c.2.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
tcawftdnyeqar

Timeline for d4b8zd_:

• d4b8zd_ first appeared in SCOPe 2.02
  
• d4b8zd_ appears in SCOPe 2.05
  
• d4b8zd_ appears in SCOPe 2.07
  
• d4b8zd_ appears in the current release, SCOPe 2.08