Lineage for d4eosa_ (4eos A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220363Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1220364Species Human (Homo sapiens) [TaxId:9606] [88856] (223 PDB entries)
    Uniprot P24941
  8. 1220610Domain d4eosa_: 4eos A: [194044]
    automated match to d3bhta_
    complexed with 1ro

Details for d4eosa_

PDB Entry: 4eos (more details), 2.57 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with the inhibitor RO3306
PDB Compounds: (A:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eosa_:

Sequence, based on SEQRES records: (download)

>d4eosa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d4eosa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d4eosa_:

Click to download the PDB-style file with coordinates for d4eosa_.
(The format of our PDB-style files is described here.)

Timeline for d4eosa_:

  • d4eosa_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-27
  • d4eosa_ appears in SCOPe 2.03
  • d4eosa_ appears in the current release, SCOPe 2.07, called d4eosa1