SCOPe 2.06: Domain d4eopa1: 4eop A:1-297

Lineage for d4eopa1 (4eop A:1-297)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (374 PDB entries)
   Uniprot P24941

8. Domain d4eopa1: 4eop A:1-297 [194038]
   Other proteins in same PDB: d4eopa2, d4eopb1, d4eopb2, d4eopc2, d4eopd1, d4eopd2
   automated match to d3bhta_
   complexed with 1ro, mg, sgm

Details for d4eopa1

PDB Entry: 4eop, 1.99 Å

PDB Description: Thr 160 phosphorylated CDK2 Q131E - human cyclin A3 complex with the inhibitor RO3306

PDB Compounds: (A:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eopa1:

Sequence, based on SEQRES records:

>d4eopa1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records):

>d4eopa1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtegvpstaireisllkelnhpn
ivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshr
vlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyyst
avdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpk
warqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Timeline for d4eopa1:

• d4eopa1 first appeared in SCOPe 2.02, called d4eopa_
  
• d4eopa1 was called d4eopa_ in SCOPe 2.05
  
• d4eopa1 appears in SCOPe 2.07
  
• d4eopa1 appears in the current release, SCOPe 2.08