Lineage for d4eoqc_ (4eoq C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434070Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1434071Species Human (Homo sapiens) [TaxId:9606] [88856] (335 PDB entries)
    Uniprot P24941
  8. 1434321Domain d4eoqc_: 4eoq C: [194034]
    Other proteins in same PDB: d4eoqb1, d4eoqb2, d4eoqd1, d4eoqd2
    automated match to d3bhta_
    complexed with atp, mg, sgm

Details for d4eoqc_

PDB Entry: 4eoq (more details), 2.15 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with ATP
PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eoqc_:

Sequence, based on SEQRES records: (download)

>d4eoqc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
plgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records): (download)

>d4eoqc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
plgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtqdfskvvppldedgr
sllsqmlhydpnkrisakaalahpffqdvtkpvphl

SCOPe Domain Coordinates for d4eoqc_:

Click to download the PDB-style file with coordinates for d4eoqc_.
(The format of our PDB-style files is described here.)

Timeline for d4eoqc_: