Lineage for d4hzra_ (4hzr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218236Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 2218237Species Human (Homo sapiens) [TaxId:9606] [111201] (8 PDB entries)
    Uniprot Q07912 117-389
  8. 2218238Domain d4hzra_: 4hzr A: [194026]
    automated match to d1u54a_
    complexed with cl, edo, so4

Details for d4hzra_

PDB Entry: 4hzr (more details), 1.31 Å

PDB Description: Crystal structure of Ack1 kinase domain
PDB Compounds: (A:) Activated CDC42 kinase 1

SCOPe Domain Sequences for d4hzra_:

Sequence, based on SEQRES records: (download)

>d4hzra_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaq

Sequence, based on observed residues (ATOM records): (download)

>d4hzra_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgvvrrgewdapsgktvsvavkclamddfirevnamhsldhrn
lirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskrf
ihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfs
hasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcw
ahkpedrptfvalrdflleaq

SCOPe Domain Coordinates for d4hzra_:

Click to download the PDB-style file with coordinates for d4hzra_.
(The format of our PDB-style files is described here.)

Timeline for d4hzra_: