SCOPe 2.02: Domain d3uleg_: 3ule G:

Lineage for d3uleg_ (3ule G:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family)

5. Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)

6. Protein automated matches [190348] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187175] (12 PDB entries)

8. Domain d3uleg_: 3ule G: [193999]
   automated match to d3dxkg_
   complexed with atp, c69, ca

Details for d3uleg_

PDB Entry: 3ule, 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP

PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d3uleg_:

Sequence, based on SEQRES records:

>d3uleg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records):

>d3uleg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeeagpdegevdsclrqgnmtaalqaalknppintksqavkdr
agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
aggvgsivrvltarktv

Timeline for d3uleg_:

• d3uleg_ is new in SCOPe 2.02-stable
  
• d3uleg_ appears in SCOPe 2.03
  
• d3uleg_ appears in the current release, SCOPe 2.08