Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) |
Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins) |
Protein automated matches [190348] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187175] (12 PDB entries) |
Domain d3uleg_: 3ule G: [193999] automated match to d3dxkg_ complexed with atp, c69, ca |
PDB Entry: 3ule (more details), 2.5 Å
SCOPe Domain Sequences for d3uleg_:
Sequence, based on SEQRES records: (download)
>d3uleg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw hekalaaggvgsivrvltarktv
>d3uleg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvgeydenkfvdeeagpdegevdsclrqgnmtaalqaalknppintksqavkdr agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala aggvgsivrvltarktv
Timeline for d3uleg_: