Lineage for d3v9ma_ (3v9m A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733485Species Pseudechis australis [TaxId:8670] [193996] (1 PDB entry)
  8. 2733486Domain d3v9ma_: 3v9m A: [193998]
    automated match to d1ae7a_
    complexed with ca, edo, peg, so4

Details for d3v9ma_

PDB Entry: 3v9m (more details), 1.56 Å

PDB Description: Phospholipase ACII4 from Australian King Brown Snake
PDB Compounds: (A:) Phospholipase A2 isozyme PA-11

SCOPe Domain Sequences for d3v9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v9ma_ a.133.1.2 (A:) automated matches {Pseudechis australis [TaxId: 8670]}
nliqfgnmiqcankgsrpsldyadygcycgwggsgtpvdeldrccqvhdncyeqagkkgc
fpkltlyswkctgnvptcnskpgcksfvcacdaaaakcfakapykkenynidtkkrck

SCOPe Domain Coordinates for d3v9ma_:

Click to download the PDB-style file with coordinates for d3v9ma_.
(The format of our PDB-style files is described here.)

Timeline for d3v9ma_: