Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (27 species) not a true protein |
Species Pseudechis australis [TaxId:8670] [193996] (1 PDB entry) |
Domain d3v9ma_: 3v9m A: [193998] automated match to d1ae7a_ complexed with ca, edo, peg, so4 |
PDB Entry: 3v9m (more details), 1.56 Å
SCOPe Domain Sequences for d3v9ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v9ma_ a.133.1.2 (A:) automated matches {Pseudechis australis [TaxId: 8670]} nliqfgnmiqcankgsrpsldyadygcycgwggsgtpvdeldrccqvhdncyeqagkkgc fpkltlyswkctgnvptcnskpgcksfvcacdaaaakcfakapykkenynidtkkrck
Timeline for d3v9ma_: