SCOPe 2.02: Domain d4h53b_: 4h53 B:

Lineage for d4h53b_ (4h53 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein automated matches [193245] (2 species)
   not a true protein

7. Species Influenza a virus [TaxId:382827] [193246] (5 PDB entries)

8. Domain d4h53b_: 4h53 B: [193986]
   automated match to d1ivga_
   complexed with ca, gol, nag, slb

Details for d4h53b_

PDB Entry: 4h53, 1.5 Å

PDB Description: influenza n2-tyr406asp neuraminidase in complex with beta-neu5ac

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4h53b_:

Sequence; same for both SEQRES and ATOM records:

>d4h53b_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgdsgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

Timeline for d4h53b_:

• d4h53b_ is new in SCOPe 2.02-stable
  
• d4h53b_ appears in SCOPe 2.03
  
• d4h53b_ appears in the current release, SCOPe 2.08