Lineage for d4irob_ (4iro B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1716759Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)
  8. 1716777Domain d4irob_: 4iro B: [193973]
    Other proteins in same PDB: d4iroa_, d4iroc_
    automated match to d2h8fb_
    complexed with cmo, hem

Details for d4irob_

PDB Entry: 4iro (more details), 2.2 Å

PDB Description: Crystal structure of T-state carbonmonoxy hemoglobin from Trematomus bernacchii at pH 8.4
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4irob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d4irob_:

Click to download the PDB-style file with coordinates for d4irob_.
(The format of our PDB-style files is described here.)

Timeline for d4irob_: