Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (11 PDB entries) |
Domain d4irob_: 4iro B: [193973] Other proteins in same PDB: d4iroa_, d4iroc_ automated match to d2h8fb_ complexed with cmo, hem |
PDB Entry: 4iro (more details), 2.2 Å
SCOPe Domain Sequences for d4irob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]} vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh aftaetqgafqkflavvvsalgkqyh
Timeline for d4irob_: