Lineage for d4irod_ (4iro D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474002Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1474071Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (11 PDB entries)
  8. 1474089Domain d4irod_: 4iro D: [193972]
    Other proteins in same PDB: d4iroa_, d4iroc_
    automated match to d2h8fb_
    complexed with cmo, hem

Details for d4irod_

PDB Entry: 4iro (more details), 2.2 Å

PDB Description: Crystal structure of T-state carbonmonoxy hemoglobin from Trematomus bernacchii at pH 8.4
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4irod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irod_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d4irod_:

Click to download the PDB-style file with coordinates for d4irod_.
(The format of our PDB-style files is described here.)

Timeline for d4irod_: