Lineage for d4akda_ (4akd A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137196Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1137214Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1137215Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 1137321Protein automated matches [190387] (2 species)
    not a true protein
  7. Species Artocarpus integer [TaxId:3490] [193965] (1 PDB entry)
  8. 1137323Domain d4akda_: 4akd A: [193968]
    automated match to d1vboa_
    complexed with cd, cl

Details for d4akda_

PDB Entry: 4akd (more details), 2.1 Å

PDB Description: High resolution structure of Mannose Binding lectin from Champedak (CMB)
PDB Compounds: (A:) mannose-specific lectin km+

SCOPe Domain Sequences for d4akda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akda_ b.77.3.1 (A:) automated matches {Artocarpus integer [TaxId: 3490]}
masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk
lpyknvkielqfpeeflvsvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegty
fnlpienglivgfkgrtgdlldaigvhmal

SCOPe Domain Coordinates for d4akda_:

Click to download the PDB-style file with coordinates for d4akda_.
(The format of our PDB-style files is described here.)

Timeline for d4akda_: