SCOPe 2.04: Domain d1e7bb3: 1e7b B:389-580

Lineage for d1e7bb3 (1e7b B:389-580)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries)
   Uniprot P02768 29-596

8. Domain d1e7bb3: 1e7b B:389-580 [19395]
   complexed with hlt

Details for d1e7bb3

PDB Entry: 1e7b, 2.38 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic halothane

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d1e7bb3:

Sequence; same for both SEQRES and ATOM records:

>d1e7bb3 a.126.1.1 (B:389-580) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasq

Timeline for d1e7bb3:

• d1e7bb3 first appeared (with stable ids) in SCOP 1.55
  
• d1e7bb3 appears in SCOPe 2.03
  
• d1e7bb3 appears in SCOPe 2.05
  
• d1e7bb3 appears in the current release, SCOPe 2.08