SCOPe 2.06: Domain d4g01b_: 4g01 B:

Lineage for d4g01b_ (4g01 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)

8. Domain d4g01b_: 4g01 B: [193949]
   automated match to d2efhb_
   complexed with ca, gdp

Details for d4g01b_

PDB Entry: 4g01, 2.2 Å

PDB Description: ara7-gdp-ca2+/vps9a

PDB Compounds: (B:) Ras-related protein RABF2b

SCOPe Domain Sequences for d4g01b_:

Sequence; same for both SEQRES and ATOM records:

>d4g01b_ c.37.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp

Timeline for d4g01b_:

• d4g01b_ first appeared in SCOPe 2.02
  
• d4g01b_ appears in SCOPe 2.05
  
• d4g01b_ appears in SCOPe 2.07
  
• d4g01b_ appears in the current release, SCOPe 2.08