SCOPe 2.02: Domain d3vvwb_: 3vvw B:

Lineage for d3vvwb_ (3vvw B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (5 PDB entries)

8. Domain d3vvwb_: 3vvw B: [193944]
   automated match to d2zjdc_

Details for d3vvwb_

PDB Entry: 3vvw, 2.5 Å

PDB Description: ndp52 in complex with lc3c

PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3C

SCOPe Domain Sequences for d3vvwb_:

Sequence; same for both SEQRES and ATOM records:

>d3vvwb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkqrkslairqeevagirakfpnkipvvverypretflppldktkflvpqeltmtqflsi
irsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtyasqetfg

Timeline for d3vvwb_:

• d3vvwb_ is new in SCOPe 2.02-stable
  
• d3vvwb_ appears in SCOPe 2.03
  
• d3vvwb_ appears in the current release, SCOPe 2.08