Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (18 species) not a true protein |
Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries) |
Domain d4f0uf_: 4f0u F: [193922] automated match to d3dbjb_ complexed with cyc |
PDB Entry: 4f0u (more details), 2.5 Å
SCOPe Domain Sequences for d4f0uf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0uf_ a.1.1.3 (F:) automated matches {Synechococcus elongatus [TaxId: 1140]} mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg vpigatvqaiqaikevtaslvgpdagremgvyldyissgls
Timeline for d4f0uf_: