SCOPe 2.08: Domain d3vpmb1: 3vpm B:66-350

Lineage for d3vpmb1 (3vpm B:66-350)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries)

8. Domain d3vpmb1: 3vpm B:66-350 [193903]
   Other proteins in same PDB: d3vpma2, d3vpmb2
   automated match to d2uw2a1
   complexed with fe, mg; mutant

Details for d3vpmb1

PDB Entry: 3vpm, 2.7 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3vpmb1:

Sequence; same for both SEQRES and ATOM records:

>d3vpmb1 a.25.1.2 (B:66-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeavdlskdiqhweslkpeery
fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik
dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw
lkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt
ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

Timeline for d3vpmb1:

• d3vpmb1 first appeared in SCOPe 2.02, called d3vpmb_
  
• d3vpmb1 appears in SCOPe 2.07