SCOPe 2.03: Domain d3w32a_: 3w32 A:

Lineage for d3w32a_ (3w32 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
   PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82796] (38 PDB entries)
   Uniprot P00533 702-1018

8. Domain d3w32a_: 3w32 A: [193901]
   automated match to d2gs6a_
   complexed with so4, w32

Details for d3w32a_

PDB Entry: 3w32, 1.8 Å

PDB Description: EGFR kinase domain complexed with compound 20a

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3w32a_:

Sequence; same for both SEQRES and ATOM records:

>d3w32a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
deayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvq
iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
idvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyra
lmdeedmddvvdadeyl

Timeline for d3w32a_:

• d3w32a_ first appeared in SCOPe 2.02
  
• d3w32a_ appears in SCOPe 2.04
  
• d3w32a_ appears in the current release, SCOPe 2.08