SCOPe 2.08: Domain d2pi7b_: 2pi7 B:

Lineage for d2pi7b_ (2pi7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [193897] (1 PDB entry)

8. Domain d2pi7b_: 2pi7 B: [193898]
   automated match to d2hc1a_
   complexed with no3

Details for d2pi7b_

PDB Entry: 2pi7, 2.59 Å

PDB Description: structure of the catalytic domain of the chick retinal neurite inhibitor-receptor protein tyrosine phosphatase cryp-2/cptpro

PDB Compounds: (B:) Protein tyrosine phosphatase CRYP-2

SCOPe Domain Sequences for d2pi7b_:

Sequence; same for both SEQRES and ATOM records:

>d2pi7b_ c.45.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkltnpvqlddfdgyikdmakdsdykfslqfeelkligldiphfaadlpmnrcknrytni
lpydfsrvrlvsmneeegsdyinanyipgynspqeyiatqgplpetrndfwkmvlqqksq
iivmltqcnekrrvkcdhywpftedpiaygditvemlseeehtdwvyrnfrisyadevqd
vmhfnytawpdhgvptanaaesilqfvqmvrqksvkskgpmiihcsagvgrtgtfialdw
llqhirdhefvdilglvsdmrsyrmsmvqteeqyifihqcvqlmwqkkk

Timeline for d2pi7b_:

• d2pi7b_ first appeared in SCOPe 2.02
  
• d2pi7b_ appears in SCOPe 2.07