SCOPe 2.05: Domain d3bj91_: 3bj9 1:

Lineage for d3bj91_ (3bj9 1:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3bj91_: 3bj9 1: [193896]
   automated match to d2cd0a_
   complexed with edo

Details for d3bj91_

PDB Entry: 3bj9, 2 Å

PDB Description: crystal structure of the surrogate light chain variable domain vprebj

PDB Compounds: (1:) Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1

SCOPe Domain Sequences for d3bj91_:

Sequence; same for both SEQRES and ATOM records:

>d3bj91_ b.1.1.0 (1:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlhqppamssalgttirltctlrndhdigvysvywyqqrpghpprfllryfsqsdksqgp
qvpprfsgskdvarnrgylsiselqpedeamyycamgarsthvfgsgtqltvlsaa

Timeline for d3bj91_:

• d3bj91_ first appeared in SCOPe 2.02
  
• d3bj91_ appears in SCOPe 2.04
  
• d3bj91_ is called d3bj911 in SCOPe 2.06
  
• d3bj91_ appears in the current release, SCOPe 2.08, called d3bj911