SCOPe 2.02: Domain d2oila_: 2oil A:

Lineage for d2oila_ (2oil A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [192727] (8 PDB entries)

8. Domain d2oila_: 2oil A: [193881]
   automated match to d2gzha_
   complexed with gdp, mg, unx

Details for d2oila_

PDB Entry: 2oil, 2.3 Å

PDB Description: crystal structure of human rab25 in complex with gdp

PDB Compounds: (A:) Ras-related protein Rab-25

SCOPe Domain Sequences for d2oila_:

Sequence; same for both SEQRES and ATOM records:

>d2oila_ c.37.1.8 (A:) automated matches {Homo sapiens [TaxId: 9606]}
edynfvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavkaqiw
dtagleryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvmlvgnk
sdlsqarevpteearmfaenngllfletsaldstnvelafetvlkeifakvskq

Timeline for d2oila_:

• d2oila_ is new in SCOPe 2.02-stable
  
• d2oila_ appears in SCOPe 2.03
  
• d2oila_ appears in the current release, SCOPe 2.08