SCOPe 2.02: Domain d2j20b_: 2j20 B:

Lineage for d2j20b_ (2j20 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (25 PDB entries)

8. Domain d2j20b_: 2j20 B: [193868]
   automated match to d3igla_
   complexed with so4, zn; mutant

Details for d2j20b_

PDB Entry: 2j20, 1.8 Å

PDB Description: human p53 core domain mutant m133l-v203a-n239y-n268d-r273c

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2j20b_:

Sequence; same for both SEQRES and ATOM records:

>d2j20b_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgtr
vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhsv
vvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevcvca
cpgrdrrteeenlr

Timeline for d2j20b_:

• d2j20b_ is new in SCOPe 2.02-stable
  
• d2j20b_ appears in SCOPe 2.03
  
• d2j20b_ appears in the current release, SCOPe 2.08